PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10007525
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 181aa    MW: 19867.5 Da    PI: 6.9306
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10007525genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.52.2e-4391081100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp e+r da+sslvyeA ar+rdP+yG+vg i+ lq+q++ql+ +lal++
  Lus10007525   9 PCASCKLLRRRCAKDCIFAPYFPSHDPHKFAIVHKVFGASNVSKMLQDLPVERRADAVSSLVYEAGARVRDPIYGCVGAISYLQRQVSQLQMQLALAQ 106
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  Lus10007525 107 AE 108
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.4838109IPR004883Lateral organ boundaries, LOB
PfamPF031959.5E-439106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MVAGASTSPC ASCKLLRRRC AKDCIFAPYF PSHDPHKFAI VHKVFGASNV SKMLQDLPVE  60
RRADAVSSLV YEAGARVRDP IYGCVGAISY LQRQVSQLQM QLALAQAEIL CIAGQQFKAA  120
AAAPNYNLAM ISDDDNYTTN SESSLDDVVL DNNKSLFLLQ HGLQVGQNHH HDDHRQYIDF  180
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012471684.16e-69PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW32e-67LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0D2QTT27e-69A0A0D2QTT2_G
STRINGSolyc06g082310.2.12e-67(Solanum lycopersicum)
STRINGPGSC0003DMT4000782562e-67(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.16e-60LBD family protein